IMGBIN - Download Transparent PNG Images, For Free.
Get access to more than 7 million free transparent PNG files. Created by designers, for designers.
W3Bin.com - Who is hosting that website?
Websites hosted by: Bluehost
 
On this page you can find a list with all websites hosted by internet service provider Bluehost. This list contains only the websites we have in our database, so it is possible that Bluehost actually hosts more websites than are currently displayed in this list.
Hot Bluehost Hosting Deals!
Thousands of established websites trust their hosting needs at Bluehost. Here at W3bin we can offer the following discount for new Bluehost customers:
Bluehost Domains
Domain Traffic Last Update
#951 countryroadbrittanys.com n/a 1 day ago
#952 agentiiimobiliare.ro 90 1 day ago
#953 northriveroutfitting.com 19 1 day ago
#954 bluelotusgardens.com n/a 1 day ago
#955 michellejensenblog.com 29 1 day ago
#956 studyinbulgaria.com 81 1 day ago
#957 mol-innov.com n/a 1 day ago
#958 nadimtwal.com 238 1 day ago
#959 miramichiphoto.com n/a 1 day ago
#960 procopyonline.com n/a 1 day ago
#961 familyrelationslaw.com 57 1 day ago
#962 semaserramenti.it 14 1 day ago
#963 baterienotebooku.cz n/a 1 day ago
#964 etrader.org n/a 1 day ago
#965 nisarandsons.com n/a 1 day ago
#966 jwcabinetry.com n/a 1 day ago
#967 mtmhomeschool4art.com 148 1 day ago
#968 acdlearningsolutions.com n/a 1 day ago
#969 geekrealestatemarketing.com 95 1 day ago
#970 customelectronicsdesign.com n/a 1 day ago
#971 kccplaybook.org n/a 1 day ago
#972 mulemotherbooks.com 5 1 day ago
#973 asthmaactionplanreview.com n/a 1 day ago
#974 rejuva.ca 14 1 day ago
#975 phoenixportablestorage.com n/a 1 day ago
#976 jobsincentralflorida.com n/a 1 day ago
#977 scribbleslrngcenter.com n/a 1 day ago
#978 allrecipesglutenfree.com n/a 1 day ago
#979 baloot-studio.com n/a 1 day ago
#980 midilistud.com n/a 1 day ago
#981 zestyourlife.com n/a 1 day ago
#982 worldofwarcraftbrasil.com 29 1 day ago
#983 susanforsheriff.com n/a 1 day ago
#984 grainbridgeblog.com 10 1 day ago
#985 shoppingandinfo.com 24 1 day ago
#986 satoru.us n/a 1 day ago
#987 regaengineering.com n/a 1 day ago
#988 rivelino.com.mx n/a 1 day ago
#989 deepcreeklakefamilyactivities.com n/a 1 day ago
#990 mepdesigneng.com n/a 1 day ago
#991 homesforsalesaltlakecity.com n/a 1 day ago
#992 inversiontablesreviewonline.com n/a 1 day ago
#993 kannalife.com 143 1 day ago
#994 firstchoicecarpetcleaning.net n/a 1 day ago
#995 thestudiocloud.com n/a 1 day ago
#996 scripophilyantiquestockcertificates.com n/a 1 day ago
#997 dektorpse.com n/a 1 day ago
#998 findcnatraining.com n/a 1 day ago
#999 printme1.com 19 1 day ago
#1000 st.com.tw 19 1 day ago
Download Transparent PNG Images, For Free
Get access to more than 7 million free transparent PNG files. Created by designers, for designers.
Recent Hosting Reports
Our Hosting Infographic
Hosting Infographic
Join our newsletter!